PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00000792_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 135aa    MW: 14811.8 Da    PI: 8.4917
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00000792_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.51.4e-2162111150
                            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalp 50 
                                       +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l+  p
  FANhyb_icon00000792_a.1.g00001.1  62 PCAACKILRRRCAEKCVLAPYFPPSEPAKFTIAHRVFGASNIIKFLQVYP 111
                                       7*********************************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.25661135IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-2062111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MECSTDTSFN TPNSTTYAPS TPFSHHSPSS SSRSSSPPIT PTQIPTQAQT QIPLPQNIVV  60
SPCAACKILR RRCAEKCVLA PYFPPSEPAK FTIAHRVFGA SNIIKFLQVY PSLQFNFSTQ  120
LVDWSEFQLG LGAYV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294671.14e-50PREDICTED: LOB domain-containing protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-32LOB domain-containing protein 1